SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012433 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012433
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 5.63e-47
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012433   Gene: ENSGGOG00000012749   Transcript: ENSGGOT00000012793
Sequence length 159
Comment pep:novel chromosome:gorGor3.1:15:54674644:54683481:-1 gene:ENSGGOG00000012749 transcript:ENSGGOT00000012793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEVAVVTTERAKHFYSPQDIPVTLYSDANEWEMWKSRSDPVLHIDLRRWADLLLVAPLDA
NTLGKVASGICDNLLTCVIRAWDRSKPLLFCPAMNTAMWEHPITAQQVDQLKAFGYVEIP
CVAKKLVCGDEGLGAMAEVGTIMDKVKEVLFQHSGFQQS
Download sequence
Identical sequences ENSGGOP00000012433 ENSGGOP00000012433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]