SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012494 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012494
Domain Number 1 Region: 400-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-26
Family MAM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 137-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000392
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 49-185
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000628
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012494   Gene: ENSGGOG00000012812   Transcript: ENSGGOT00000012856
Sequence length 554
Comment pep:novel chromosome:gorGor3.1:X:13515877:13580314:1 gene:ENSGGOG00000012812 transcript:ENSGGOT00000012856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPWSLALPLLLPWVAGSFGNAASARHHGLLASARQPGVCHYGTKLACCYGWRRNSKGV
CEATCEPGCKFGECVGPNKCRCFPGYTGKTCSQDVNECGMKPRPCQHRCVNTHGSYKCFC
LSGHMLMPDATCMNSRTCAMINCQHGCEDTEEGPQCLCPSSGLRLAPNGRDCLDIDECAS
GKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCSHHANCFNTQ
GSFKCKCKQGYKGNGLRCSAIPENSVKEVLRAPGTIKDRIKKLLAHKNSMKKKVKIKNVT
PEPTRTPTPKVNLQPFNYEEIVSRGGNSHGGKKGNEEKMKEGLEDEKREEKALKNDIEER
SLRGDVFFPKVNEAGEFGLVLVQRKALTSKLEHKADLNISVDCSFNHGICDWKQDREDDF
DWNPADRDNAIGFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLR
VFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTGEIAVDGVLL
VSGLCPDSLLSVDD
Download sequence
Identical sequences G3RAM1
XP_004063852.1.27298 ENSGGOP00000012494 ENSGGOP00000012494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]