SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012548 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012548
Domain Number 1 Region: 33-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.44e-99
Family Integrin alpha N-terminal domain 0.0000000000000279
Further Details:      
 
Domain Number 2 Region: 774-999
Classification Level Classification E-value
Superfamily Integrin domains 2.35e-64
Family Integrin domains 0.00025
Further Details:      
 
Domain Number 3 Region: 483-635
Classification Level Classification E-value
Superfamily Integrin domains 1.41e-35
Family Integrin domains 0.0000986
Further Details:      
 
Domain Number 4 Region: 636-733
Classification Level Classification E-value
Superfamily Integrin domains 1.1e-27
Family Integrin domains 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012548   Gene: ENSGGOG00000012852   Transcript: ENSGGOT00000012910
Sequence length 1038
Comment pep:novel chromosome:gorGor3.1:5:39700352:39717072:1 gene:ENSGGOG00000012852 transcript:ENSGGOT00000012910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSHFGFSLDFHKDS
HGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLLDLRDETRNVGSQTLQTFKA
RQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGN
TLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRP
GILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEI
LDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDWDGYNDVAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYR
AQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQ
LDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSL
NVSLPPTEAGLAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADN
VLELQMDAANEGEGAYEAELAVHLPQGAHYMQALSNVEGFERLICNQKKENETRVVLCEL
GNPMKKNAQVRLLGRGTGSPPGAHEQPDFRGASRYKNSQNPNSKIVLLDVPVRAEAQVEL
RGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPS
DLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPTPSPSPIHPAHHKRDRRQIFLPEPEQPS
RLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWF
NVSSLPYAVPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKV
GFFKRNRPPLEDDDEEGE
Download sequence
Identical sequences ENSGGOP00000012548 ENSGGOP00000012548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]