SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012639 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012639
Domain Number 1 Region: 334-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-30
Family SPRY domain 0.0026
Further Details:      
 
Domain Number 2 Region: 157-268
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-17
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012639   Gene: ENSGGOG00000012955   Transcript: ENSGGOT00000013003
Sequence length 495
Comment pep:novel chromosome:gorGor3.1:19:4406436:4426076:1 gene:ENSGGOG00000012955 transcript:ENSGGOT00000013003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVVQEALRKIIKTLAVKNEEIQSFIYSLKQMLLNVEANSAKVQEDLEAEFQSLFSLLEE
LKEGMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQAMDSEDFPQAAKQI
KDGVTMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPVIDLAESLVADN
CVTLVWRMPDEDSKIDHYVLEYRRTNFEGPPRLKEDQPWMVIEGIRQTEYTLTGLKFDMK
YMNFRVKACNKAVAGEFSEPVTLETPAFMFRLDASTSHQNLRVDDLSVEWDAMGGKVQDI
KAREKDGKGRTASPINSPAGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEVR
YEPDSKAFGVGVAYRSLGRFEQLGKTAASWCLHVNNWLQVSFTAKHANKVKVLDAPVPDC
LGVHCDFHQGLLSFYNARTKQVLHTFKTRFTQPLLPAFTVWCGSFQVTTGLQVPSAVRCL
QKRGSATSSSNTSLT
Download sequence
Identical sequences ENSGGOP00000012639 ENSGGOP00000012639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]