SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012705 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012705
Domain Number 1 Region: 1121-1257,1317-1603
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.17e-109
Family Myotubularin-like phosphatases 0.00000402
Further Details:      
 
Domain Number 2 Region: 1672-1871
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-26
Family Pleckstrin-homology domain (PH domain) 0.0000024
Further Details:      
 
Domain Number 3 Region: 889-1031
Classification Level Classification E-value
Superfamily PH domain-like 0.000000799
Family GRAM domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012705   Gene: ENSGGOG00000013005   Transcript: ENSGGOT00000013071
Sequence length 1874
Comment pep:novel chromosome:gorGor3.1:22:35307872:35338351:-1 gene:ENSGGOG00000013005 transcript:ENSGGOT00000013071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLADYFVLVAFGPHPRGSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPER
NPPTFFVAVLTDINSERHYCACLTFWEPAEPSQETTRVEDATEREEEGDEGGQTHLSPTA
PAPSAQLFAPKTLVLVSRLDHTEVFRNSLGLIYAIHVEGLNVCLENVIGNLLTCTVPLAG
GSQQRTISLGAGDRQVIQTPLADSLPVSRCSVALLFRQLGITNVLSLFCAALTEHKVLFL
SRSYQRLADACRGLLALLFPLRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQEL
LDVIVADLDGGTVTIPECVHIPLLPEPLQSQTHSVLSMVLDPELELADLAFPPPTTSTSS
LKMQDKELRAVFLRLFAQLLQGYRWCLHVVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKV
LEGMAFAGFVSERGVPYRPTDLFDELVAHEVARMRADENHPQRVLRHVQELAEQLYKNEN
PYPAVAMHKVQRPGESSHLRRVPRPFPRLDEGTVQWIVDQAAAKMQGAPPAVKAERRTTV
PSGPPMTAILERCSGLHVNSARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARR
CLAQELHLHVQQNRAVLDHQQFDFVVRMMNCCLQDCTSLDEHGIAAALLPLVTAFCRKLS
PGVTQFAYSCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEPTEDLSPAQEVGEAPSQED
ERSALDVASEQRRLWPTLSREKQQELVQKEESTVFSQAIHYANRMSYLLLPLDSSKSRLL
RERAGLGDLESASNSLVTNRPSMAGSVAESYDTESGFEDAETCDVAGAVVRFINRFVDKV
CTESGVTSDHLKGLHVMVPDIVQMHIETLEAVQRESRRLPPIQKPKLLRPRLLPGEECVL
DGLRVYLLPDGREEGAGGSAGGPALLPAEGAVFLTTYRVIFTGMPTDPLVGEQVVVRSFP
VAALTKEKRISVQTPVDQLLQDGLQLRSCTFQQLLKMAFDEEVGSDSAELFRKQLHKLRY
PPDVRATFAFTLGSAHTPGRPPRVTKDKGPSLRTLSRNLVKNAKKTIGRQHVTRKKYNPP
SWEQRGQPPPEDQEDEISVSEELEPSTLTPSSALKPSDRMTMSSLVERACCRDYQRLGLG
TLSSSLSRAKSEPFRISPVNRMYAICRSYPGLLIVPQSVQDNALQRVSRCYRQNRFPVVC
WRSGRSKAVLLRSGGLHGKGVVGLFKAQNAPSPGQSQADSSSLEQEKYLQAVVSSMPRYA
DASGRNTLSGFSSAHMGSHGKWGSVRTSGRSSGLGTDVGSRLAGRDALAPPQANGGPPDP
GFLRPQRAALYILGDKAQLKGVRPDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPA
AEPSPASFLRSLEDSEWLIQIHKLLQVSVLVVELLDSGSSVLVGLEDGWDITTQVVSLVQ
LLSDPFYRTLEGFRLLVEKEWLSFGHRFSHRGAHTLAGQSSGFTPVFLQFLDCVHQVHLQ
FPMEFEFSQFYLKFLGYHHVSRRFRTFLLDSDYERIELGLLYEEKGERRGQLPCRSVWEY
VDRLSKRTPVFHNYMYAPEDAEVLRPYSNVSNLKVWDFYTEETLAEGPPYDWELAQGPPE
PPEEERSDGGAPQSRRRVVWPCYDSCPRAQPDAISRLLEELQRLETELGRPTERWKDTWD
RVKAAQRLEGRPDGRGTPSSLLVSTAPHHRRSLGVYLQEGPVGSTLSLSLDSDQSSGSTA
SGSRQAARRSTSTLYSQFQTAESENRKCRSYEGTLYKKGAFMKPWKARWFVLDKTKHQLR
YYDHRVDTECKGVIDLAEVEAVAPGTPTMGAPKTVDEKAFFDVKTTRRVYNFCAQDVPSA
QQWVDRIQSCLSDA
Download sequence
Identical sequences ENSGGOP00000012705 ENSGGOP00000012705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]