SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000012838 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000012838
Domain Number 1 Region: 40-418
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 5.65e-79
Family UDP-N-acetylglucosamine 2-epimerase 0.0013
Further Details:      
 
Domain Number 2 Region: 440-748
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.51e-57
Family ROK 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000012838   Gene: ENSGGOG00000013160   Transcript: ENSGGOT00000013209
Sequence length 753
Comment pep:novel chromosome:gorGor3.1:9:36965749:37026525:-1 gene:ENSGGOG00000013160 transcript:ENSGGOT00000013209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METYGYLQRESCFQGPHELYFKNLSKRNKQIMEKNGNNRKLRVCVATCNRADYSKLAPIM
FGIKTEPEFFELDVVVLGSHLIDDYGNTYRMIEQDDFDINTRLHTIVRGEDEAAMVESVG
LALVKLPDVLNRLKPDIMIVHGDRFDALALATSAALMNIRILHIEGGEVSGTIDDSIRHA
ITKLAHYHVCCTRSAEQHLISMCEDHDRILLAGCPSYDKLLSAKNKDYMSIIRMWLGDDV
KSKDYIVALQHPVTTDIKHSIKMFELTLDALISFNKRTLVLFPNIDAGSKEMVRVMRKKG
IEHHPNFRAVKHVPFDQFIQLVAHAGCMIGNSSCGVREVGAFGTPVINLGTRQIGRETGE
NVLHVRDADTQDKILQALHLQFGKQYPCSKIYGDGNAVPRILKFLKSIDLQEPLQKKFCF
PPVKENISQDIDHILETLSALAVDLGGTNLRVAIVSMKGEIVKKYTQFNPKTYEERINLI
LQMCVEAAAEAVKLNCRILGVGISTGGRVNPREGIVLHSTKLIQEWNSVDLRTPLSDTLH
LPVWVDNDGNCAALAERKFGQGKGLENFVTLITGTGIGGGIIHQHELIHGSSFCAAELGH
LVVSLDGPDCSCGSHGCIEAYASGMALQREAKKLHDEDLLLVEGMSVPKDEAVGALHLIQ
AAKLGNAKAQSILRTAGTALGLGVVNILHTMNPSLVILSGVLASHYIHIVKDVIRQQALS
SVQDVDVVVSDLVDPALLGAASMVLDYTTRRIY
Download sequence
Identical sequences A0A2I2ZRR3 A0A2J8T0A8
NP_001121699.1.87134 NP_001121699.1.92137 XP_018889060.1.27298 ENSP00000367134 gi|190014632|ref|NP_001121699.1| ENSP00000379839 ENSGGOP00000012838 ENSGGOP00000012838 ENSP00000379839 9606.ENSP00000379839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]