SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013311 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013311
Domain Number 1 Region: 262-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-16
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 104-166
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-16
Family KRAB domain (Kruppel-associated box) 0.0036
Further Details:      
 
Domain Number 3 Region: 370-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000071
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 300-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000672
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013311   Gene: ENSGGOG00000013643   Transcript: ENSGGOT00000013693
Sequence length 438
Comment pep:novel chromosome:gorGor3.1:12:46281434:46292077:-1 gene:ENSGGOG00000013643 transcript:ENSGGOT00000013693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAEDRSQFGSAAEMLSEQTAALGTGWESMNVQLDGAEPQVERGSQEERPWRTVPGPLEH
LCCDLEEEPQSLQEKAQSAPWVPAIPQEGNTGDWEMAAALLAAGSQGLVTIKDVSLCFSQ
EEWRSLDPSQTDFYGEYVMQENCGIVVSLRFPIPKLDMLSQLEGGEEQWVPDPQDLEERD
ILRVTYTGDGSEHEGDTPELEAEPPRMLSSVSEDTVLWNPEHDESWDSMPRSSRGMLLGP
PFLQEDSFSNLLCSTEMDSLLRPHTCPQCGKQFVWGSHLARHQQTHTGERPYSCLKCEKS
FGRRHHLIRHQKTHLHDKPSRCSECGKNFRCNSHLASHQRVHAEGKSCKGQEVGESPGTR
KRQRAPPVPKCHVCTECGKSFGRRHHLVRHWLTHTGEKPFQCPRCEKSFGRKHHLDRHLL
THQGQSPRNSWDRGTSVF
Download sequence
Identical sequences A0A2I2YBI3
ENSGGOP00000013311 ENSGGOP00000013311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]