SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013381 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013381
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 8.5e-40
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 2 Region: 533-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.71e-25
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013381   Gene: ENSGGOG00000013712   Transcript: ENSGGOT00000013767
Sequence length 677
Comment pep:novel chromosome:gorGor3.1:7:98071379:98082396:-1 gene:ENSGGOG00000013712 transcript:ENSGGOT00000013767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAPLAAGGEEAAATTSVPGSPGLPGRRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSLLPPYICQLPLRVLIVSNNKLGALPPDIGTLGSLRQLDVSSNELQSLPSELCG
LSSLRDLNVRRNQLNTLPEELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQVCLKGKLHIFKYLSTEAGQRGSALGDLAPSRPPSFSPCPAEDLFPGHRYDGGLDS
GFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPREHKEDGSADGDSEQIDFIDSH
VPGEDEERGTVEEQRPPELSPGAGDRERAPSSRREEPAGEERRRPDTLQLWQERERRQQQ
QSGAWGAPRKDSLLKPGLRAVVGGAAAVSTQAMHNGPPKSSASQAGAAAGQGAPAPPTSR
EAGGVGARPLGPSYRVSGEQWRHPHAPLFLLGPSSPDSVLRPRRYPQVPDEKDLMTQLRQ
VLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVPSPAVPKLSALKARKNVES
FLEACRKMGVPEADLCSPSDLLQGTARGLRTALEAVKRVGGKALPPLWPPSGLGGFIVFY
VVLMLLLYVTYTRLLGS
Download sequence
Identical sequences ENSGGOP00000013381 ENSGGOP00000013381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]