SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013425 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013425
Domain Number 1 Region: 95-195
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-31
Family SH2 domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 40-91
Classification Level Classification E-value
Superfamily SH3-domain 0.00000149
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013425   Gene: ENSGGOG00000013765   Transcript: ENSGGOT00000013813
Sequence length 289
Comment pep:novel chromosome:gorGor3.1:8:132917394:132983721:-1 gene:ENSGGOG00000013765 transcript:ENSGGOT00000013813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWASPAAPGKKKEMGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGE
KLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGS
FMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGL
CCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSY
GLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED
Download sequence
Identical sequences ENSGGOP00000013425 ENSGGOP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]