SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013779 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013779
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily SH2 domain 9.56e-24
Family SH2 domain 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013779   Gene: ENSGGOG00000014121   Transcript: ENSGGOT00000014173
Sequence length 132
Comment pep:novel chromosome:gorGor3.1:1:141509036:141523848:-1 gene:ENSGGOG00000014121 transcript:ENSGGOT00000014173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFTEICFSFRTFTEKP
IYYILQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETF
VNSNSDYVDVLP
Download sequence
Identical sequences ENSGGOP00000013779 ENSGGOP00000024916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]