SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013789 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013789
Domain Number 1 Region: 284-406
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-28
Family SH2 domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013789   Gene: ENSGGOG00000014130   Transcript: ENSGGOT00000014183
Sequence length 411
Comment pep:novel chromosome:gorGor3.1:9:38732601:38881625:-1 gene:ENSGGOG00000014130 transcript:ENSGGOT00000014183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGS
PHLYRSSSERRPATPAEVRYISPKHRLIKVESVAGGGAGDPLGGACAGGRTWSPTACGGK
KLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIM
TEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQ
PWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGER
VDPAVPLEKQIWYHGAISRGDAENLLRLCKECSYLVRNSQTSKHDYSLSLRSNQGFMHMK
LAKTKEKYVLGQNSPPFDSVPEVIHYYTTRKLPIKGAEHLSLLYPVAVRTL
Download sequence
Identical sequences G3RE19
ENSGGOP00000013789 ENSGGOP00000013789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]