SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013792 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013792
Domain Number 1 Region: 237-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.23e-45
Family Decarboxylase 0.00000651
Further Details:      
 
Domain Number 2 Region: 14-204
Classification Level Classification E-value
Superfamily PRTase-like 4.69e-43
Family Phosphoribosyltransferases (PRTases) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013792   Gene: ENSGGOG00000014137   Transcript: ENSGGOT00000014186
Sequence length 480
Comment pep:novel chromosome:gorGor3.1:3:124422993:124434985:1 gene:ENSGGOG00000014137 transcript:ENSGGOT00000014186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARAALGPLVTGLYDVQAFKFGDFVLKSGLSSPIYIDLRGIVSRPRLLSQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQMHGIRLHSVCTLSKML
EILEQQKKIDAETVGRVKRFIQENVFVAANHNGSPLSIKEAPKELSFGARAELPRIHPVA
SKLLRLMQKKETNLCLSADVSEARELLELADALGPSICMLKTHVDILNDFTLDVMKELIT
LAKRHEFLIFEDRKFADIGNTVKKQYEGKHFSLNLVTDIWLCYITFFVGIFESFIQTFFS
LHRVFLKIREYSCLLKLDSHHRQYLSVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQ
LEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLGV
Download sequence
Identical sequences ENSGGOP00000013792 ENSGGOP00000019183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]