SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013891 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013891
Domain Number 1 Region: 362-648
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.62e-92
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000779
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013891   Gene: ENSGGOG00000014234   Transcript: ENSGGOT00000014291
Sequence length 657
Comment pep:novel chromosome:gorGor3.1:12:69126079:69415383:-1 gene:ENSGGOG00000014234 transcript:ENSGGOT00000014291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYQHSQDIEKSLDIAPQK
IYRHSYDSSSEAQVSKHHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
YKTILPNPFSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
TSIGCRQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
Download sequence
Identical sequences G3REB0
ENSGGOP00000013891 ENSGGOP00000022716 ENSGGOP00000013891 XP_004053614.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]