SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000013900 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000013900
Domain Number 1 Region: 46-184,238-495
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 4.84e-110
Family Proton glutamate symport protein 0.00000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000013900   Gene: ENSGGOG00000014246   Transcript: ENSGGOT00000014300
Sequence length 574
Comment pep:novel chromosome:gorGor3.1:11:35829068:35996499:-1 gene:ENSGGOG00000014246 transcript:ENSGGOT00000014300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK
Download sequence
Identical sequences A0A2I2ZRF1 A0A2I3RPT6 P43004
ENSGGOP00000013900 ENSPTRP00000006085 9598.ENSPTRP00000006085 9606.ENSP00000278379 ENSP00000278379 ENSP00000278379 ENSP00000278379 gi|40254478|ref|NP_004162.2| NP_004162.2.87134 NP_004162.2.92137 XP_003313030.1.37143 XP_004050990.1.27298 ENSPTRP00000006085 ENSGGOP00000013900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]