SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014372 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014372
Domain Number 1 Region: 2020-2182
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-28
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1744-1856
Classification Level Classification E-value
Superfamily CalX-like 3.4e-19
Family CalX-beta domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014372
Domain Number - Region: 391-428
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0196
Family Purple acid phosphatase, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014372   Gene: ENSGGOG00000014708   Transcript: ENSGGOT00000014783
Sequence length 2183
Comment pep:novel chromosome:gorGor3.1:9:14988355:15163988:-1 gene:ENSGGOG00000014708 transcript:ENSGGOT00000014783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSLSCGTANALLLLLLLAWASPTFISINRGVRVMKGHSAFLSGDDLKFAIPKEKDACKV
EVVMNEPITQRVGKLTPQVFDCHFLPNEVKYVHNGCPILDEDTVKLRLYRFTETDTFIET
FILWVYLLEPDCNIIHMSNNVLEVPEFNGLSQAIDKNLLRFDYDRMASLECTVSLDTART
RLPAHGQMVLGEPRPEEPRGDQPHSFFPESQLRAKLKCPGGICTPGLKKIGSLKVSCEEF
LLMGLRYQHLDPPSPNTDYISIQLDLTDTRSKIVYKKSESAWLPVYIRAGIPNQIPKAAF
MAMFILEVDQFILTSLTTSVLDCEEDETPKPLLVFNITKAPLQGYVTHLLDHTRPISSFT
WKDLSDMQIAYQPPNSSHSERRHDEVELEVYDFFFERSAPMTVHISIRTADTNAPRVSWN
TGLSLLEGQSRAITWEQFQIVDNDDIGAVRLVTVGGLQHGWLTLRGGKGFLFTVADLQAG
VVRYHHDDSDSTKDFVVFRIFDGHHSIRHKFPINVLPKDDSPPFLITNVVIELEEGQTIL
IQGSMLQASDVDASDDYIFFNITKPPQAGEIMKKPGPGLIGYPVPGFLQRDLFNGIIYYR
HFGGEIFEDSFQFVLWDSHEPPNLSVPQVATIHITPVDDQLPKEAPGVSRHLVVKETEVA
HITKKQLHFIDSESYDRELVYTITTPPFFSFSHRHLDAGKLFMVDSIPKVVKNPTALELR
SFTQHAVNYMKVAYMPPMQDIGPHCRDVQFTFSVSNQHGGTLHGICFNITILPVDNQVPE
AFTNPLKVTEGGQSIISTEHILISDADTKLDNIDLSLRELPLHGRVELNGFPLNSGGTFS
WGDLHTLKVSYLLDREPCLVQDDILLEVTDGANSAEFVLHVEVFPVNDEPPVLKADLMPV
MNCSEGGEVVITSEYIFATDVDSDNLKLMFVIAREPQHGVVRRAGVTVDQFSQRDVISEA
VTYKHTGGEIGMMPCFDTITLVVSDGEAGPFVNGCCYNGPNPSVPLHASFPVYDLNITVY
PVDNQPPSIAIGPMFVVDEGCSTALTVNHLSATDPDTAADDLEFVLVSPPQFGYLENILP
SVGFEKSNIGISIDSFQWKDMNAFHINYVQSRHLRTEPTADQFTVYVTDGKQHSLEIPFS
IIINPTNDEAPDFVVQNITVCEGQMKELDSSIISAVDLDIPQDALLFSITQKPRHGLLID
RGFSKDFSENKQPANPHQKHAPVHSFSMELLKTGMRLTYMHDDSESLVDDFTIQLSDGKH
KILKTISVEVIPVNDEKPMLSKKAEIAMNMGETRIISSAILSAIDEDSPREKIYYVFERL
PQNGQLQLKIGRDWVPLSPGMKCTQEEVDLNLLRYTHTGAMDSQNQDSFTFYLWDGNNRS
PALDCQITIKDMEKGDIVILTKPLVVSKGDRGFLTTTTLLAVDGTDKPEELLYVITSPPR
YGQIEYVHYPGVPITNFSQMDIAGETVCYVHKSKVTVSSDRFRFIISNGLRTEHGVFEIT
LETVDRALPVVTRNKGLRLAQGAVGLLSPDLLQLTDPDTPAENLTFLLVQLPQHGQLYLW
GTGLLQHNFTQQDVHSRNVAYRHSGGDSQTDCFTFMATDGTNQGFIVNGRVWEEPVLFTI
QVDQLDKTAPRITLLHSPSQVGLLKNGCYGIYITSRVLKASDPDTEDDQIIFKILQGPKH
GHLENTTTGEFIHEKFSQKDLNSKTILYIINPSLEVNSDTVEFQIMDPTGNSATPQIHSL
ELKWSHIEWSQTKYEVCENVGVLPLEIIRRGYSMDSAFVGIKVNQVSAAVGKDFTVIPSK
LIQFDPGMSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGAKTKAAVKILDSKGGQCH
PSYSSNQSKHSTWEKGIWHLLPPGSSSSTTSGSFHLERRPLPSSMQLAVTRGDTLRGFDS
TDLSQRNLRTRGNGKTVRPSSVYRNGTDIIYNYHGIVSLKLKDDSFPTHKRKAKVSIISQ
PQKTIKVAELPQADKVESTTDSHFPRQDQLPSFPKNCTLELKGLFHFEEGIQKLYRCNGV
AWKAWSPQTKVVEDKSCPAGWHQHSGYCHILITEQKGTWNAAAQACREQYLGNLVTVFSR
QHMRWLWDIGGRKSFWIGLNDQVRAGHWQWIGGEPVAFTNGRRGPSQRSKLGKSCVLVQR
QGKWQTKDCRRAKPHNYMCSRKL
Download sequence
Identical sequences ENSGGOP00000014372 ENSGGOP00000016888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]