SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014648 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014648
Domain Number 1 Region: 905-1183
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.78e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000144
Further Details:      
 
Domain Number 2 Region: 419-598
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000304
Family Fibronectin type III 0.0071
Further Details:      
 
Domain Number 3 Region: 706-798
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000013
Family Fibronectin type III 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014648
Domain Number - Region: 616-695
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000204
Family Fibronectin type III 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014648   Gene: ENSGGOG00000014998   Transcript: ENSGGOT00000015061
Sequence length 1205
Comment pep:novel chromosome:gorGor3.1:12:15643904:15752854:1 gene:ENSGGOG00000014998 transcript:ENSGGOT00000015061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLFCFIQQNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFEFEEFNS
TLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETG
VLFEIHYPEKYNVFTRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVS
EATFNKSTLVEYSGVSHEPKQHRTAPYPPQNISVRIVNLNKNNWEEQSGNFPEESFMRSQ
DTIGKEKLFHFTEEIPEIPSGNISSGWPDFNSSDYETTSQPYWWDSASAAPESEDEFVSV
LPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYLM
VDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKP
QHVSVHVLSSTTALMSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPII
ENLVPGAQYQVVIYLRKGPLIGPPSDPVTFAIVPTGIKDLMLYPLGPTAVVLSWTRPYLG
VFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLPAWYYNFRVTMVTWGDP
ELSCCDSSTISFITAPVAPEITSVEYFNSLLYISWTYGDDTTDLSHSRMLHWMVVAEGKK
KIKKSVTRNVMTAILSLPPGDIYNLSVTACTERGSNTSMLRLVKLEPAPPKSLFAVNKTQ
TSVTLLWVEEGVADFFEVFCQQVGSSQKTKLQKPQEPVAVSSHVVTISSLLPATAYNCSV
TSFSHDSPSVPTFIAVSTMVTEMNPNVVVISVLAILSTLLIGLLLVTLIILRKKHLQMAR
ECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFYINPWSKNGLKKRK
LTKQSPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNI
LPYDFSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQ
IIVMLTQCNEKRRVKCDHYWPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQD
VMHFNYTAWPDHGVPTANAAESILQFVHMVRQQATKSKGPMIIHCSAGVGRTGTFIALDR
LLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKKQQFCISDVIYE
NVSKS
Download sequence
Identical sequences ENSGGOP00000014648 ENSGGOP00000014648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]