SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014740 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014740
Domain Number 1 Region: 402-488
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.53e-23
Family Canonical RBD 0.0027
Further Details:      
 
Domain Number 2 Region: 29-67
Classification Level Classification E-value
Superfamily SAP domain 0.000000011
Family SAP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014740   Gene: ENSGGOG00000015093   Transcript: ENSGGOT00000015157
Sequence length 952
Comment pep:novel chromosome:gorGor3.1:19:5736018:5777297:-1 gene:ENSGGOG00000015093 transcript:ENSGGOT00000015157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETLPGSGDSGPGTASLGAGVAESGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERL
KKAVKEEGQDPDEIGIELEATSKKSAKRCVKGLKMEEEGTEDNGLEDDSRDGQEDMEASL
ENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEH
AVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPF
AQDTSSVGPDRKLAEEEDLFDSAHPEEGDLDLASESTAHAQSSKADSLLAVVKREPAEQP
GDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDA
CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVSSSSGRNLWVSGLSSTTRA
TDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSDEATKCISHLHRTELHGRMISV
EKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKQAEDI
KKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERSSKSQD
RKSESKEKRILSFDKIKEQRERERQRQREREIRETERRREREQREREQRLEAFHERKEKA
RLQRERLQLECQRQRLERERLERERLERERMRVERERRKEQELIHREREELRRQQEQPRY
EQERRPGRRPYDLDRRDDAYWPEGKRVAMEDRYRADFPRPDHRFHDFDHRDRGQYQDHAI
DRREGSRPMMGDHRDGQHYGDDRHGHGGPPERHGRDSRDGWGGYGSDKRLSEGRGLPPPP
RGGRDWGEHNQRLEEHQARAWQGAMDAGTASREHTRWQGGERGLSGPSGPGHMASRGGVA
GRGGFAQGGHSQGHVVPGGGLEGGGVASQDRGSRVPHPHPHPPPYPHFTRRY
Download sequence
Identical sequences ENSGGOP00000014740 ENSGGOP00000014740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]