SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014796 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014796
Domain Number 1 Region: 358-498
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-40
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 2 Region: 653-787
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-38
Family C-type lectin domain 0.000000106
Further Details:      
 
Domain Number 3 Region: 1222-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 1.3e-35
Family C-type lectin domain 0.00019
Further Details:      
 
Domain Number 4 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.93e-35
Family Cysteine rich domain 0.000000804
Further Details:      
 
Domain Number 5 Region: 236-353
Classification Level Classification E-value
Superfamily C-type lectin-like 1.14e-29
Family C-type lectin domain 0.00093
Further Details:      
 
Domain Number 6 Region: 1094-1219
Classification Level Classification E-value
Superfamily C-type lectin-like 3.48e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 7 Region: 508-646
Classification Level Classification E-value
Superfamily C-type lectin-like 1.73e-22
Family C-type lectin domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000014796
Domain Number - Region: 797-849
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0145
Family C-type lectin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014796   Gene: ENSGGOG00000015154   Transcript: ENSGGOT00000015218
Sequence length 1457
Comment pep:novel chromosome:gorGor3.1:10:18303523:18401387:1 gene:ENSGGOG00000015154 transcript:ENSGGOT00000015218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLLVFASVIPGAVLLLDTRQFLIYNEDHKRCVDAVSPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDNLCSRGYEGLDTSLFSLTPYPFCFPIGFETNMPR
VWYMSLASISPALNMSWLMMTSTTNPKTKCLLSFLPLRVEGSESLWNKDPLTSISYQINS
KSALTWHQARKSCQQQNAELLSITEIHEQTYLTDIGLTSSLTSGLWIGLNSLSFNSGWQW
SDRSPFRYLNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVI
PSESDVPTHCPSQWWPYAGHCYKIHRDEKKIQRDALTTCRKEGGDLTSIHTIEEFDFIIS
QLGYEPNDELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGY
WADRGCEWPLGYICKMKSRSEGPEIVEVEKGCRKLWEPHRFSFYRLQESLQKWKSIYFTC
SKEVTKLWSFSTRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVLFTHWNSD
MPGRKPGCVAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGA
SSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHEL
FWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHL
NNWICQIQKGQTPKPEPTPAPQDNPPVTEDGWVTYKDYQYYFSKEKETMEKCRCPVMESE
LCQISNNNKKSRLWVNNFLWRNSFILMTPMRAERLTEEVKVEWSETALEHKGRNNKNKPT
NKIYNLTNSEKQHCSFFDKVYISQKWNKNTHKTLKWRGLNIVRKREWERTFNMCFVVEIC
LDCNRFSGSETLSQDNGGKGNRVSGELLKSQGMGYRCADFTVTCLLKYVATNKNHLQIFN
DLRKQKSWHFCSEGQGQWQVMSLRTKDQKAEVIWLVGAPTPRSVWVRLWEALPVGEGHRK
SSRLDPSLTNPPATIQTAGFIKYGKSSYSLMRQKFQWHEAETYCKLHNSLIASILDPYSN
AFAWLQMETSNERVWIALNSNLTDNQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYW
KTAHCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQA
SLECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGTWLWINNSPVSFVN
WNTGDPSGERNDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAKPTHELLTTKADTRKM
DPSKPSSNVAGVVIIVILLILTGAGLAAYFFYKKRRVHLPQEGAFENTLYFNSQSSPGTS
DMKDLVGNIEQNEHSVI
Download sequence
Identical sequences ENSGGOP00000014796 ENSGGOP00000026085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]