SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000014984 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000014984
Domain Number 1 Region: 422-683
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.78e-76
Family Eukaryotic proteases 0.00000000798
Further Details:      
 
Domain Number 2 Region: 25-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-30
Family Spermadhesin, CUB domain 0.00000054
Further Details:      
 
Domain Number 3 Region: 183-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-28
Family Spermadhesin, CUB domain 0.00000179
Further Details:      
 
Domain Number 4 Region: 365-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000848
Family Complement control module/SCR domain 0.00000715
Further Details:      
 
Domain Number 5 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0000629
Further Details:      
 
Domain Number 6 Region: 134-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000271
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000014984   Gene: ENSGGOG00000015360   Transcript: ENSGGOT00000015412
Sequence length 685
Comment pep:novel chromosome:gorGor3.1:1:11250065:11269340:-1 gene:ENSGGOG00000015360 transcript:ENSGGOT00000015412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYTNDQERRWTLTAPPGYRLRLYF
THFDLELSHLCEYDFVKLSSGTKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSDY
SNEKPFTGFEAFYAAEDIDECQVAXXXXPPPPPPCHNHLGGFYCSCRAGYVLHRNKRTCS
ALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETLC
PYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPCP
YPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDQPMPTC
SIVDCGPPDDLPSGQVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTSS
KGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTA
AHAIYEQKHDASSLDIRMGALKRLSPHYTQAWAEAVFIHEGYTHDAGFDNDIALIKLNNK
VVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTAA
YEKPPYPGGSVTANMLCAGLESGGKDSCRGDSGGALVFPDSETQRWFVGGIVSWGSMNCG
EAGQYGVYTKVINYIPWIENIISNF
Download sequence
Identical sequences ENSGGOP00000014984 ENSGGOP00000019440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]