SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015202 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015202
Domain Number 1 Region: 179-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.43e-57
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.12e-31
Family Tetramerization domain of potassium channels 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015202   Gene: ENSGGOG00000015582   Transcript: ENSGGOT00000015637
Sequence length 655
Comment pep:novel chromosome:gorGor3.1:1:114755708:114971690:-1 gene:ENSGGOG00000015582 transcript:ENSGGOT00000015637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFIDEQMFEQNCMESSMQNYPSTRSPSLSSHP
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Download sequence
Identical sequences A0A0D9S6F4 A0A2K5J2B8 A0A2K6AAE9 A0A2K6CJ17 A0A2K6K8L5 A0A2K6PZE9 F7GH76 G1QVI2 G3RHS4 G7NW61 H2N6D2 H2RI65 Q9UK17
gi|27436984|ref|NP_004971.2| ENSPPYP00000001194 ENSMMUP00000019025 ENSP00000319591 ENSGGOP00000015202 9544.ENSMMUP00000019025 9600.ENSPPYP00000001194 9606.ENSP00000319591 ENSPPYP00000001194 NP_001265396.1.72884 NP_004971.2.87134 NP_004971.2.92137 XP_002810479.1.23681 XP_003268027.1.23891 XP_003810737.1.60992 XP_004026395.1.27298 XP_005270908.1.92137 XP_005542398.1.63531 XP_006710692.1.92137 XP_007975751.1.81039 XP_007975752.1.81039 XP_010357370.1.97406 XP_011735373.1.29376 XP_011735374.1.29376 XP_011735376.1.29376 XP_011735377.1.29376 XP_011788563.1.43180 XP_011856122.1.47321 XP_015002182.1.72884 XP_015002187.1.72884 XP_016781156.1.37143 XP_016781158.1.37143 XP_016856733.1.92137 XP_017725177.1.44346 XP_017725179.1.44346 XP_017725180.1.44346 XP_017725181.1.44346 XP_018874194.1.27298 XP_018874260.1.27298 XP_018874323.1.27298 XP_018874341.1.27298 ENSGGOP00000015202 ENSMMUP00000019026 ENSNLEP00000004954 ENSP00000319591 ENSPTRP00000061222 ENSNLEP00000004953 ENSPTRP00000061222 ENSP00000319591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]