SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015219 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015219
Domain Number 1 Region: 623-733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 2 Region: 784-890
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 3 Region: 473-576
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 4 Region: 358-467
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-35
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 5 Region: 914-1007
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 6 Region: 154-351
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.97e-27
Family Astacin 0.0072
Further Details:      
 
Domain Number 7 Region: 734-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000028
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 578-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015219   Gene: ENSGGOG00000015595   Transcript: ENSGGOT00000015654
Sequence length 1018
Comment pep:novel chromosome:gorGor3.1:10:109707197:109853746:-1 gene:ENSGGOG00000015595 transcript:ENSGGOT00000015654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRATALEALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAV
FWGDIALDEDDLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAG
KDGQENTTLPHSPGTLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIF
KQAMRHWEKHTCVTFIERTDEESFIVFSYRTCGKRDSMKTRGTGTRRATEGTGGVSCEDL
KMAQQGLQHLAGGGVEYEKKCPTWFSKGLTQCCVTGQEYNFLKMEAGEVSSLGETYDFDS
IMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQD
TTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWR
KAPLLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAVYEATCGGDINKDAGQIQS
PNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALMGH
FCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLG
SYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYR
ISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGKFCGSETPEVITSQSNNMRVEFKSD
NTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYQLHENGHDCKEAGCA
HKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMY
DGPDSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEV
QTKELYSHAQFGDNNYPSQAHCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGY
DSSAPRLGRFCGSGPLEEIYSAGDSLMIRFCTDDTINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences ENSGGOP00000018130 ENSGGOP00000015219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]