SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015264 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015264
Domain Number 1 Region: 334-495
Classification Level Classification E-value
Superfamily EF-hand 3.66e-21
Family Calmodulin-like 0.0083
Further Details:      
 
Domain Number 2 Region: 103-316
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 4.45e-20
Family Glycerol-3-phosphate (1)-acyltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015264   Gene: ENSGGOG00000015639   Transcript: ENSGGOT00000015700
Sequence length 534
Comment pep:novel chromosome:gorGor3.1:17:92652863:92718708:1 gene:ENSGGOG00000015639 transcript:ENSGGOT00000015700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLV
AAAMMLLAWPLALVASLGSAEKEPEQPLALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGR
QALPTEAAILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQ
DSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPN
KLDTITWTWQGPGALEILWLTLCQFHNHVEIEFLPVYSPSEEEKRNPALYASNVRRVMAE
ALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERAR
MKGGEKIGIAEFAASLEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDT
IQLAFKMYGAQEDGSVGEGDLSCILKTALGVAELTVTDLFRAIDQEQKGKITFADFHRFA
EMYPDFAEEYLYPDQTHFESCAETPPAPIPNGFCADFSPENSDAGEKPVRKKLD
Download sequence
Identical sequences G3RHY4
XP_004059129.2.27298 ENSGGOP00000015264 ENSGGOP00000015264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]