SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015408 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015408
Domain Number 1 Region: 2-74
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.28e-16
Family FHA domain 0.0000145
Further Details:      
 
Domain Number 2 Region: 245-305
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000095
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015408   Gene: ENSGGOG00000015792   Transcript: ENSGGOT00000015850
Sequence length 622
Comment pep:novel chromosome:gorGor3.1:12:132976329:133011157:-1 gene:ENSGGOG00000015792 transcript:ENSGGOT00000015850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIY
LVYRKNEPEHNVAYLYESLNEKQGMTQESFEANKENVFHGIKDTSGAGAGRGADPRVPPS
SPASQVCFEEPQPSTSTSDLFPTASASSTEPSPAGRERSSSCGSGGGGISPKGSGPSVAS
DEVSSFASALPDRKTASFSSLEPQDQEDLEPLKKKMRGDGDLDLNGQLLVAQPRRNAQTV
HEDVRAAAGKPDKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRC
PVERICKNHILNNLVEAYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGS
SEDLLELSDVDSESSDISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTS
VSLTTARGSRCYPGSQSVSLAFFQPGADELCWRQPSALSACNECPPSTGAVCLQPFCHLY
WGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDILKNYLATRGLTWKNMLSESLVA
LQQGVFLLSEGRVEGHTMLCGSTGVILFPQLGFYFLMRTPSLFPVAVTSRPDCYWGRNCR
TQVKAHHAMKFNHICEQTRFKN
Download sequence
Identical sequences ENSGGOP00000022139 ENSGGOP00000015408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]