SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015431 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015431
Domain Number 1 Region: 670-962
Classification Level Classification E-value
Superfamily L domain-like 3.74e-48
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 2 Region: 390-624
Classification Level Classification E-value
Superfamily L domain-like 2.45e-33
Family Ngr ectodomain-like 0.023
Further Details:      
 
Domain Number 3 Region: 229-453
Classification Level Classification E-value
Superfamily L domain-like 3.91e-30
Family Ngr ectodomain-like 0.0036
Further Details:      
 
Domain Number 4 Region: 70-193
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 6.54e-29
Family Cofilin-like 0.0014
Further Details:      
 
Domain Number 5 Region: 1058-1212
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.62e-26
Family Toll/Interleukin receptor TIR domain 0.0003
Further Details:      
 
Domain Number 6 Region: 1-53
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.00000000193
Family Cofilin-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015431   Gene: ENSGGOG00000015810   Transcript: ENSGGOT00000015874
Sequence length 1227
Comment pep:known chromosome:gorGor3.1:3:53560408:53578430:-1 gene:ENSGGOG00000015810 transcript:ENSGGOT00000015874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYAATRATVKKEFGGGHIKDELFGTVKDDLSFAGYQKHLSSCAAPAPLTSAERELQQIR
INEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTE
PTDVAQLPSRVPRDAARYHFFLYKHTHEGDPLESVVFIYSMPGYKCSIKERMLYSSCKSR
LLDSVEQDFHLEIAKKGFCRSALHPLSLLVQAIVLAMTLALGTLPAFLPCELQPHGLVNC
NWLFLKSVPHFSMAAPRGNVTSLSLSSNRIHHLHDSDFAHLPSLRRLNLKWNCPPVGLSP
MHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAG
LHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYL
LLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSR
LEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNY
QKRVSFAHLSLAPSFGSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQ
AQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGEEKFWLQPGDLAPAPVDTPSSED
FRPNCSTLNFTLDLSRNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQV
LDLSHNKLDLYHEHSFTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHN
NIHSQVSQQLCSTSLRALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLP
QTLRNLPKSLQVLRLRDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRR
LDVSCNSISFVAPGFFSKAKELRELNLSANALKTVDHSWFGPLASALRILDVSANPLHCA
CGAAFMDFLLEVQAAVPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLA
VALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQSGRGEDALPYDAFVVFDKTQSAVAD
WVYNELRGQLEECRGRWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSG
LLRASFLLAQQRLLEDRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSF
WAQLGMALTRDNHHFYNRNFCQGPTAE
Download sequence
Identical sequences ENSGGOP00000015431 ENSGGOP00000015431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]