SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015749 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015749
Domain Number 1 Region: 37-142
Classification Level Classification E-value
Superfamily HAD-like 1.8e-30
Family 5'(3')-deoxyribonucleotidase (dNT-2) 0.00000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015749   Gene: ENSGGOG00000016145   Transcript: ENSGGOT00000016200
Sequence length 143
Comment pep:novel chromosome:gorGor3.1:5:62312734:62332148:-1 gene:ENSGGOG00000016145 transcript:ENSGGOT00000016200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRLGGWCARRLCSAAVPAGRRGAAGGPGLAGGRALRVLVDMDGVLADFEGGFLRKFRAR
FPDQPFIALEDRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMAS
LQNTDVFICTSPIKMFKYCPYEK
Download sequence
Identical sequences ENSGGOP00000015749 ENSGGOP00000015749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]