SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015785 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015785
Domain Number 1 Region: 174-392
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.8e-85
Family Fibrinogen C-terminal domain-like 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015785   Gene: ENSGGOG00000016180   Transcript: ENSGGOT00000016236
Sequence length 394
Comment pep:novel chromosome:gorGor3.1:19:10291978:10295966:-1 gene:ENSGGOG00000016180 transcript:ENSGGOT00000016236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKPWLRALQLLLLLGASWARAGAPRCTYTFVLPPQKFTGAVCWSGPASTRAAPEAANAS
ELAALRMRVGRHEELLRELQRLQLDVKFRELPPLATQQSSLIARLERLCPGGAGGQQQVL
PPPPLVPVVPVRLVGSTNDTSRMLDPAPEPRRDQTQRQQEPLASPMPAGHPAVPTKPVGP
WQDCAEARQAGHEQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHY
KAGFGRPDGEYWLGLEHVYQLTSRGDHELLVLLEDWGGRGACAHYDGFSLEPESDHYRLR
LGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWYHACAHSNLNGVWHHGG
HYRSRYQDGVYWAEFRGGAYSLRKAAMLIRPLKL
Download sequence
Identical sequences ENSGGOP00000015785 ENSGGOP00000015785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]