SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015823 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000015823
Domain Number - Region: 212-276
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.017
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015823   Gene: ENSGGOG00000016224   Transcript: ENSGGOT00000016275
Sequence length 435
Comment pep:novel chromosome:gorGor3.1:13:90354066:91095757:-1 gene:ENSGGOG00000016224 transcript:ENSGGOT00000016275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA
EAKLTRARDKEHQQQQEPSWPALLASMGESSPAAQAHRLLSASSSPTLPPSPGDGGGGGG
KGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGD
GQEVRSKHPTPLWNLSDFYLSFCNSYTLWELFSGLSSPNTLNCSLDVVLKEGGEMTTCRQ
CVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSCPEDCKIVYKAWLCSQYFEVTQFN
CRKTIPCKQYCLEVQTRCPFILPDNDEVIYGGLSSFICTGLYETFLTNDEPECCDIRREE
KSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRLKLCVLVLILLHTVLTASAAQNTAGLS
FGGINTLEENSTNEE
Download sequence
Identical sequences ENSGGOP00000015823 ENSGGOP00000015823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]