SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000015992 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000015992
Domain Number 1 Region: 3-142
Classification Level Classification E-value
Superfamily Globin-like 8.02e-44
Family Globins 0.00000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000015992   Gene: ENSGGOG00000016396   Transcript: ENSGGOT00000016447
Sequence length 142
Comment pep:novel chromosome:gorGor3.1:16:216140:216984:1 gene:ENSGGOG00000016396 transcript:ENSGGOT00000016447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSAEDRALVRALWKKLGSNVGVYTTEALERTFLAFPATKTYFSHLDLSPGSSQVRAHG
QKVADALSLAVERLDDLPHALSALSRLHACQLRVDPASFQLLGHCLLVTLARHYPGDFSP
ALQASLDKFLSHVISALVSEYR
Download sequence
Identical sequences A0A1K0FU58 G3RJU5
ENSGGOP00000015992 ENSGGOP00000015992 XP_004056905.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]