SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016133 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016133
Domain Number 1 Region: 9-290
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016133   Gene: ENSGGOG00000016535   Transcript: ENSGGOT00000016591
Sequence length 458
Comment pep:novel chromosome:gorGor3.1:2b:17384612:17404614:1 gene:ENSGGOG00000016535 transcript:ENSGGOT00000016591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTEAGSRPENVRKN
RYKDVLPYDQTRVILSLLREEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTF
QKESRSVYQLQYMSWPDRGVPSSPDHMLVMVEEARRLQGSGPEPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS
PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPASPGHAMADTYAVVQKR
GAPAGAGRGTQTGTGTGARSAEEAPLYSQVTPRAQRPGAHAEDARGTLPGRIPADQSPAG
SGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
Download sequence
Identical sequences G3RK73
XP_004032596.1.27298 ENSGGOP00000016133 ENSGGOP00000016133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]