SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016172 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016172
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily Cystatin/monellin 2.34e-35
Family Cystatins 0.000000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016172   Gene: ENSGGOG00000016581   Transcript: ENSGGOT00000016631
Sequence length 142
Comment pep:novel chromosome:gorGor3.1:20:24472324:24476138:-1 gene:ENSGGOG00000016581 transcript:ENSGGOT00000016631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWPMHTSLLLLTALMVAVAGSASAQSRTLAGGIHAADLNDKSVQRALDFAISEYNKDIS
KDEYYSRPLQVMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS
FQINEVPWEDKISILNYKCRKV
Download sequence
Identical sequences G3RKA9
ENSGGOP00000016172 ENSGGOP00000016172 XP_004061958.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]