SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016280 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016280
Domain Number 1 Region: 261-344
Classification Level Classification E-value
Superfamily E set domains 5.88e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000016280
Domain Number - Region: 351-401
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00204
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016280   Gene: ENSGGOG00000000033   Transcript: ENSGGOT00000016741
Sequence length 591
Comment pep:novel chromosome:gorGor3.1:5:142784619:142920014:-1 gene:ENSGGOG00000000033 transcript:ENSGGOT00000016741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFGIQESIQRSGSSMKEEPLGSGMNAVRTWMQGAGVLDANTAAQSGVGLARAHFEKQPPS
NLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGI
RTEQDFYVRLIDSMTKQAIVYEGQDKNPEMCKVLFTEHLMMPRCLFKESVRNRNANHDDL
FLHRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVNVDGHVLAVSDNMFVHNNSKHG
RRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVW
SELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQK
VIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYSVPRNHNQL
PALANTSVHAGMMGVNSFSGQLAVNVSEASQATNQAGFTRNSSSVSPHGYVPSTTPQQTN
YNSVTTSMNGYGSAAMSNLGGSPTFLNGSAANSPYAIVPSSPTMASSTSLPSNCSSSSGI
FSFSPANMVSAVKQKSAFAPVVRPQTSPPPTCTSTNGNSLQAISGMIVPPM
Download sequence
Identical sequences ENSGGOP00000025403 ENSGGOP00000016280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]