SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016282 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016282
Domain Number 1 Region: 29-112
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.79e-19
Family MHC antigen-recognition domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016282   Gene: ENSGGOG00000016690   Transcript: ENSGGOT00000016743
Sequence length 247
Comment pep:novel chromosome:gorGor3.1:6:150893972:150901369:-1 gene:ENSGGOG00000016690 transcript:ENSGGOT00000016743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAAAASPAFLLRLPLLLLLSSWCRTGLADPHSLCYDITVIPEFRPGPRWCAVQGQVDKKT
FLHYDCGNKRVIPISHLGKKLNVTKAWKAQNPVLREVVDMLTEQLLDIQLENYIPRSTLE
PSAGAPPTMSSGTAQPRATATTLILCCLLIMCLLMCPRHSLTQSHGHHPQSLQPPPHPPL
LHPTWLLRRVLWSDSYQIAKHPLSGGHVTRVTLPIIGDDSHSLPCPLALYTINNSAARYS
EPLQSIS
Download sequence
Identical sequences ENSGGOP00000016282 ENSGGOP00000016282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]