SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016398 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016398
Domain Number 1 Region: 318-618
Classification Level Classification E-value
Superfamily Kelch motif 1.31e-68
Family Kelch motif 0.0000704
Further Details:      
 
Domain Number 2 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 1.41e-25
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016398   Gene: ENSGGOG00000016811   Transcript: ENSGGOT00000016862
Sequence length 641
Comment pep:novel chromosome:gorGor3.1:6:55154065:55157770:-1 gene:ENSGGOG00000016811 transcript:ENSGGOT00000016862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKKIVKKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLSCISSELTDASYGPNLL
EGLSKMRQENFLCDFVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSTQRVDLNDISPLG
LATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIREMSVENCMYVVNIAE
TYSLKNAKAAAQKFIRDNFLEFAESDQFMKLTFEQINELLIDDDLQLPSEIVAFQIAMKW
LEFDQKRVKYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHRLLVDAMNYHLLPYH
QNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTEMPAKSFNQCV
AVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLASMNQKRTHFSLSVFNGL
LYATGGRNAGGGGRNAEGSLASLECYVPSTNQWQPKTPLEVARCCHASAVADGRVLVTGG
YIANAYSRSVCAYDPASDSWQELPNLSTPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVL
TVECYSPATGQWSYAAPLQVGVSTAGVSALHGRAYLVGGWNEGEKKYKKCIQCFSPELNE
WTEDDELPEATVGVSCCTLSMPNNVTRESRASSVSSVPVSI
Download sequence
Identical sequences ENSGGOP00000016398 ENSGGOP00000016398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]