SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016417 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016417
Domain Number 1 Region: 97-244
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 4.18e-29
Family Glycerol-3-phosphate (1)-acyltransferase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016417   Gene: ENSGGOG00000016829   Transcript: ENSGGOT00000016882
Sequence length 267
Comment pep:novel chromosome:gorGor3.1:9:120312289:120326091:-1 gene:ENSGGOG00000016829 transcript:ENSGGOT00000016882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWPCLAASRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENMRLPQAWAHTWK
GFFKWVSWARDSVRFRGSLPCVSRSPAPSVFQRTGLMEVLPERCVQIAKRELLFLGPVGL
IMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYL
AVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRA
MRTTFLHISKTPQENGATAGSGVQPAQ
Download sequence
Identical sequences ENSGGOP00000016417 ENSGGOP00000023606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]