SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016468 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016468
Domain Number 1 Region: 321-399
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.09e-24
Family Intermediate filament protein, coiled coil region 0.001
Further Details:      
 
Domain Number 2 Region: 91-123
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000115
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 203-319
Classification Level Classification E-value
Superfamily Prefoldin 0.0000418
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016468   Gene: ENSGGOG00000016873   Transcript: ENSGGOT00000016933
Sequence length 467
Comment pep:novel chromosome:gorGor3.1:5:42616870:42620596:1 gene:ENSGGOG00000016873 transcript:ENSGGOT00000016933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQTCTPTFSIGSIKGLCGTAGGISRVSSIHSVGSCRVPSLAGAAGYISSARSGLSGLG
SCLPGSYLSSGCHTSGFVGSGGWFCEGSFNGSEKETMQFLNDRLANYLEKVRQLERENAE
LESCIREWYESQIPHICPDYQSYFKTIEDFQQKILLTKSENARLVLQIDNAKLAADDFRT
KYETELSLRQLVEADINGLRRILDELTLCKADLEAQVESLKEELMCLKKNHEEEVSVLRC
QLGDRLNVEVDAAPPVDLNKILEDMRCQYEALVENNRRDVEAWFNTQTEELNQQVVSSSE
QLQCCQTEIIELRRTVNALEIELQTQHSMRNSLESTLAETEASYSSQLAQMQCLISNVEA
QLSEIRCDLERQNQEYQVLLDVKARLEGEIATYRRLLEGEDCKLPLPPCATACKPVIRVP
SVPPVPCVPAVPCTPAPQVGTQIRTITEEIRDGKVISSREHMQSRPL
Download sequence
Identical sequences XP_004041724.1.27298 ENSGGOP00000016468 ENSGGOP00000016468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]