SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016553 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016553
Domain Number 1 Region: 32-156
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.92e-28
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 109-440
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000467
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016553   Gene: ENSGGOG00000016959   Transcript: ENSGGOT00000017019
Sequence length 554
Comment pep:novel chromosome:gorGor3.1:2b:97068140:97158941:1 gene:ENSGGOG00000016959 transcript:ENSGGOT00000017019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSIVLFLFSSFSAINESISSRKRHRFLEQLDSDGTITIEEQIVLVLKAKVQCELNITAQL
QEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLN
KTWANYSDCLRFLQPDISIGKQEFFERLYVMYTVGYSISFGSLAVAILIIGYFRRLHCTR
NYIHMHLFVSFMLRATSIFVKDRVVHAHIGVKELESLIMQDDPQNSTEATSVDKSQYIGC
KIAVVMFIYFLATNYYWILVEGLYLHNLIFVAFFSDTKYLWGFILIGWGFPAAFVAAWAV
ARATLADARCWELSAGDIKWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHDTRK
QYRKLAKSTLVLVLVFGVHYIVFVCLPHSFTGLGWEIRMHCELFFNSFQGFFVSIIYCYC
NGEVQAEVKKMWSRWNLSVDWKRTPPCGSRRCGSVLTTVTHSTSSQSQVAASTRMVLISG
KAAKIASRQPDSHITLPGYVWSNSEQDCLPHSFHEETKEDSGRQGDDILMEKPSRPMESN
PDTEGCQGETEDVL
Download sequence
Identical sequences ENSGGOP00000024908 ENSGGOP00000016553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]