SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016611 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016611
Domain Number 1 Region: 29-170
Classification Level Classification E-value
Superfamily EF-hand 6.32e-34
Family Calmodulin-like 0.000000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016611   Gene: ENSGGOG00000017020   Transcript: ENSGGOT00000017078
Sequence length 176
Comment pep:novel chromosome:gorGor3.1:16:31120372:31122561:1 gene:ENSGGOG00000017020 transcript:ENSGGOT00000017078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSTLTLQAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDT
FAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKG
TIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Download sequence
Identical sequences ENSGGOP00000016611 ENSGGOP00000016611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]