SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016622 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016622
Domain Number 1 Region: 2-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-37
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 2 Region: 113-227
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-34
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016622   Gene: ENSGGOG00000017032   Transcript: ENSGGOT00000017089
Sequence length 306
Comment pep:novel chromosome:gorGor3.1:1:55894289:55896215:-1 gene:ENSGGOG00000017032 transcript:ENSGGOT00000017089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCGGVLTGLSGVLTSPEYPNNYPNSMECHWVIRAPGPAHVKLVFVDFQVEGNEECTYDYV
AVLGGPGPTRGHHYCGSTRPPTLVSLGHELQVVFKSDFNIGGRGFKAYYFSGECQEVYMA
MRGNFSSPQYPSSYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFD
GASEEAPLLGNWCGHHLPPPVTSSHNQLLLLLHTDRSTTRRGFSVAYIGGQLGCGSGSTE
GEGEALQPQSLQSPSSIPPVCPAPPMNGLLQLLLRWLHPCPLSGPLRLDGTAPACFHYCR
ASFPSS
Download sequence
Identical sequences ENSGGOP00000016622 ENSGGOP00000016622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]