SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000016722 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000016722
Domain Number 1 Region: 889-1024
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.58e-26
Family cAMP-binding domain 0.0021
Further Details:      
 
Domain Number 2 Region: 656-880
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.05e-24
Family Voltage-gated potassium channels 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000016722   Gene: ENSGGOG00000017130   Transcript: ENSGGOT00000017193
Sequence length 1190
Comment pep:novel chromosome:gorGor3.1:16:47810684:47893773:-1 gene:ENSGGOG00000017130 transcript:ENSGGOT00000017193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWVQRVLPQPPGTPRKTKMQEEEKVEPEPEMEVEVEPEPNPEEAETESESMPPEESFK
EEEVAVADPSPQETKEAALTSTISLRAQGAEISEMNSPSRRVLTWLMKGVEKVIPQPVHS
VTEDSAQILGHGSTGDTGCTDEPNEALEAQDTRPGLRLLLWLEENLDRVLPQPPKSSEVW
RDEPAVATGAASDPAPPGRPQEMGPKLQARETPSLPTPVPLQPKEEPKEASAPEPQPGSQ
AQTSSLPPPRDPARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGICDVQTISILPGGQV
EPDLVLEEVEPHWEDAHQDVSTSPQGTEMVPAYEEENKAVEKMPRELSRIEEEKEDEEEE
EEEEEEEEEEEVTEVLLDSCVVSQVGVGQSEEDRTRPQSASDQKLWEEVGEEAEEEAEEK
AKEEAEEAAEEEAEKEPQDWAETKEEPEAEAEAASSGVPATKQHPEVQVEDTDADSCPLM
AEENPPSPVLLPPSPAKSDTLIVPSSASGTHRKKLPSEDDEAEELKALSPAESPVVAWSD
PTTPKDTDGQDRAASTASTNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKP
SPAKKAPEPAPDTKPAEAEPVEEEHYCDMLCCKFKRRPWKEYQFPQSIDALTNLMYVLWL
FFVVMAWNWNCWLIPVRWAFPYQTPDNIHLWLLMDYLCDLIYFLDITVFQTRLQFVRGGD
IITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNSRLE
SILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAV
KTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDST
VKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLGEIGREMYIIQAGQVQVLGGPDGKSVLVT
LKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKAR
RMLRNNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELAA
LEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKEAATDPPAPRTPPEPPGSPPSSPP
PASLGRPEGEEEGPTEPEEHSVRICMSPGPEPGEQILSVEMPEEREEKAK
Download sequence
Identical sequences ENSGGOP00000016722 ENSGGOP00000016722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]