SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017342 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017342
Domain Number 1 Region: 166-266
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.7e-33
Family GS domain 0.0000114
Further Details:      
 
Domain Number 2 Region: 24-109
Classification Level Classification E-value
Superfamily TPR-like 2.79e-20
Family Tetratricopeptide repeat (TPR) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017342   Gene: ENSGGOG00000006797   Transcript: ENSGGOT00000032438
Sequence length 365
Comment pep:novel chromosome:gorGor3.1:13:34931444:34978262:1 gene:ENSGGOG00000006797 transcript:ENSGGOT00000032438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGN
YCVAVADAKKSLELNPNNSTAMLRKGICEYHGKNYAAALETFTEGQKLDIETGFHRVGQA
GLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTE
SQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLST
KIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPHTRNWDKLVGEIREEEKN
EKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDM
EWKKY
Download sequence
Identical sequences G3QV95
XP_004054610.1.27298 ENSGGOP00000017342 ENSGGOP00000006659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]