SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000017426 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000017426
Domain Number 1 Region: 14-149
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.79e-34
Family Hormone receptor domain 0.004
Further Details:      
 
Domain Number 2 Region: 140-423
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000054
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000017426   Gene: ENSGGOG00000012496   Transcript: ENSGGOT00000027845
Sequence length 477
Comment pep:novel chromosome:gorGor3.1:unplaced:31322523:31327897:-1 gene:ENSGGOG00000012496 transcript:ENSGGOT00000027845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPCQPQRPLLLLLLLLACQPQVPSAQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNR
TFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQ
CQMDGEETEVQKEVAKMYSSFQVMYTVGYSLSLGALLLALAILGGLSKLHCTRNAIHTNL
FASFVLKASSVLVIDGLLRTRYSQKIGDDLSVSIWLSDGAVAGCRVAAVFMQYGIVANYC
WLLVEGLYLHNLLGLATLPERSFFSLYLGIGWGAPMLFVVPWAVVKCLFENVQCWTSNDN
MGFWWILRFPVFLAILINFFIFVRIIHLLVAKLRARQMHHTDYKFRLAKSTLTLIPLLGV
HEVVFAFVTDEHAQGTLRSAKLFFDLFLSSFQGLLVAVLYCFLNKEVQSELRRRWHRWRL
GKVLWEERNTSNHKASSSPGRGLPGKELQFGRGGGSQDSSAETPLAGGLPRLAESPF
Download sequence
Identical sequences G3RNQ9
ENSGGOP00000017426 ENSGGOP00000017426 XP_018875422.1.27298 XP_018875423.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]