SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000018311 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000018311
Domain Number 1 Region: 12-130
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.62e-28
Family Hormone receptor domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 213-418
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000101
Family Rhodopsin-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000018311   Gene: ENSGGOG00000011468   Transcript: ENSGGOT00000024782
Sequence length 447
Comment pep:novel chromosome:gorGor3.1:5:38225688:38254914:-1 gene:ENSGGOG00000011468 transcript:ENSGGOT00000024782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRCLGSDWMCDRALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPR
SPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYH
VAVIINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPIQVRRSIR
CLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFG
EGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYT
DYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYM
LFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIR
ARVARAMSIPTSPTRVSFHSIKQSTAV
Download sequence
Identical sequences ENSGGOP00000011185 ENSGGOP00000018311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]