SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019059 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019059
Domain Number 1 Region: 59-150
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000000000000994
Family HSP20 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019059   Gene: ENSGGOG00000016841   Transcript: ENSGGOT00000030984
Sequence length 197
Comment pep:novel chromosome:gorGor3.1:19:33053550:33056011:-1 gene:ENSGGOG00000016841 transcript:ENSGGOT00000030984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSV
ALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRR
YRLPPGVDPAAVTSALSPEGVLSIQAAPPAPREPPQAPSIKADLTPPSQMSQVRQGLSSH
PLLDSALTSILDTALIT
Download sequence
Identical sequences ENSGGOP00000019059 ENSGGOP00000016430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]