SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019528 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019528
Domain Number 1 Region: 28-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000588
Family Complement control module/SCR domain 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019528   Gene: ENSGGOG00000003347   Transcript: ENSGGOT00000034571
Sequence length 264
Comment pep:novel chromosome:gorGor3.1:10:6118218:6132294:-1 gene:ENSGGOG00000003347 transcript:ENSGGOT00000034571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPRVRGERLLQVETSSPSPVLCTFAGITCPPPMSVEHADIWVKSYSLYSRERYICNSGF
KRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVRQRPAPPSTVTTAGVTPQPESLS
PSGKEPAASSPSSNTTAATTAAIVPGSQLMPSKSPSTGTTEIGSHESSHGTPSQTTAKTW
ELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYIKSRQTPPLASVEMEA
MEALQVTGGTSSRDEDLENCSHHL
Download sequence
Identical sequences ENSGGOP00000019528 ENSGGOP00000019528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]