SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019951 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019951
Domain Number 1 Region: 134-316
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.28e-38
Family BAR domain 0.0061
Further Details:      
 
Domain Number 2 Region: 6-96
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-20
Family DBL homology domain (DH-domain) 0.0015
Further Details:      
 
Domain Number 3 Region: 369-457
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-17
Family SH3-domain 0.0000932
Further Details:      
 
Domain Number 4 Region: 515-571
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-16
Family SH3-domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019951   Gene: ENSGGOG00000027331   Transcript: ENSGGOT00000026807
Sequence length 577
Comment pep:novel chromosome:gorGor3.1:4:114967840:115013411:1 gene:ENSGGOG00000027331 transcript:ENSGGOT00000026807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSQLLKIIFRPNGLFGLFLQVSAGGKPNLLDMGSLMIKPIQRVMKYPLLLCELRNSTPP
SHPDYRALDDAFAAVKDINVNINELKRRKDLVLKYKKNDEDESLKDKLSKLNIHSISKKS
KRVTNHLKILTRGESQVKDNTFNREEKLFRALEKTVRLCVKNISLCLQHIQDAMPLALQS
VMDLQEISYNKDDEMDYSETLSNALNSCHDFASHLQRLILTPLSALLSLFPGPHKLIQKR
YDKLLDCNSYLQRSAGEESDLAKKEYEALNAQLVEELQAFNQAARKILLNCLCSFITLLR
DLMLVAQQAYSTLVPVPLLVSSISEIQNQVLEEIQNLNCVKENSATFIERKLSFEKKKPV
QILPEMPHQTDIHRSKLLSTYSAKELYQAKRKCNATQEYDINLLEGDLVAVIEQKDPLGS
TSRWLVDTGNVKGYVYSSFLKPYNPAKMQKVDAENRFCDDDFENISLFVSSRPASDSVTG
TSESSIGDSSSSLSGTCGKFETNGTDVDSFQEVDEQIFYAVHAFQARSDHELSLQEYQRV
HILRFCDLSGNKEWWLAEAQGQKGYVPANYLGKMTYA
Download sequence
Identical sequences ENSGGOP00000019951 ENSGGOP00000019951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]