SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000019985 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000019985
Domain Number 1 Region: 134-273
Classification Level Classification E-value
Superfamily ISP domain 2.49e-38
Family Rieske iron-sulfur protein (ISP) 0.000000659
Further Details:      
 
Domain Number 2 Region: 79-147
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 4.58e-24
Family ISP transmembrane anchor 0.0000309
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily Non-globular alpha+beta subunits of globular proteins 1.77e-17
Family Ubiquinol-cytochrome c reductase 8 kDa protein 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000019985   Gene: ENSGGOG00000012978   Transcript: ENSGGOT00000025231
Sequence length 274
Comment pep:novel chromosome:gorGor3.1:19:26289280:26295451:-1 gene:ENSGGOG00000012978 transcript:ENSGGOT00000025231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVAARSGPFAPVLSATSRDYALSFRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGV
TTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
Download sequence
Identical sequences ENSGGOP00000022470 ENSGGOP00000019985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]