SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020109 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020109
Domain Number 1 Region: 142-301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.58e-44
Family Dual specificity phosphatase-like 0.000095
Further Details:      
 
Domain Number 2 Region: 12-140
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 8.91e-26
Family Cell cycle control phosphatase, catalytic domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020109   Gene: ENSGGOG00000025169   Transcript: ENSGGOT00000033018
Sequence length 665
Comment pep:novel chromosome:gorGor3.1:12:12525594:12574092:-1 gene:ENSGGOG00000025169 transcript:ENSGGOT00000033018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHEMIGTQIVTERLVALLESGTEKVLLIDSRPFVEYNTSHILEAININCSKLMKRRLQQ
DKVLITELIQHSAKHKVDIDCSQKVVVYDQSSQDVASLSSDCFLTVLLGKLEKSFSSVHL
LAGGFAEFSRCFPGLCEGKSTLVPTCISQPCLPVANIGPTRILPNLYLGCQRDVLNKELM
QQNGIGYVLNASNTCPKPDFIPESHFLRVPVNDSFCEKILPWLDKSVDFIEKAKASNGCV
LVHCLAGISRSATIAIAYIMKRMDMSLDEAYRFVKEKRPTISPNFNFLGQLLDYEKKIKN
QTGASGPKSKLKLLNLEKPNEPVPAVSEGGQKSETPLSPPCADSATSEAAGQRPVHPASV
PSMPSVQPSLLEDSPLVQALSGLHLSADRLEDSNKLKRSFSLDIKSVSYSASMAASLHGF
SSSEDALEYYKPSTTLDGTNKLCQFSPVQELSEQTPETSPDKEEASIPKKPQTTRPSDSQ
SKRLHSVRTSSSGTAQRSLLSPLHRSGSVEDNYHTSFLFGLSTSQQHLTKSAGLGLKGWH
SDILAPQTSAPSLTSSWYFATESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRR
QKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGESIMSENRSREELGKVGSQSSFSGSME
IIEVS
Download sequence
Identical sequences G3RWC6
XP_004052795.1.27298 ENSGGOP00000020109 ENSGGOP00000020109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]