SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020176 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020176
Domain Number 1 Region: 16-294
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020176   Gene: ENSGGOG00000007036   Transcript: ENSGGOT00000026856
Sequence length 435
Comment pep:novel chromosome:gorGor3.1:20:48506342:48529687:1 gene:ENSGGOG00000007036 transcript:ENSGGOT00000026856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVHTSELSPCISHIAWLSLIQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQKDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSPPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT
Download sequence
Identical sequences ENSGGOP00000020176 ENSGGOP00000020176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]