SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000020861 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000020861
Domain Number 1 Region: 427-573
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-29
Family SPRY domain 0.00052
Further Details:      
 
Domain Number 2 Region: 222-281
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.43e-17
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 11-51,179-211
Classification Level Classification E-value
Superfamily RING/U-box 3.91e-17
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000020861
Domain Number - Region: 263-385
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0602
Family Apolipoprotein A-I 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000020861   Gene: ENSGGOG00000006885   Transcript: ENSGGOT00000006909
Sequence length 576
Comment pep:novel chromosome:gorGor3.1:5:165775359:165786167:1 gene:ENSGGOG00000006885 transcript:ENSGGOT00000006909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAMTPNPVQTLQEEAVCAICLDYFTDPVSIGCGHNFCRVCVTQLWGGEDEEDGEELD
REEEEDGEEEEVEAVGAGAGWDTPMRDEDYEGDMEEEIEEEEEGVFWTSGMSRASWDNMD
YVWEEEEEEEDLDYYLGDMEEEDLRGEDEEDEEEVLEEGEEEDLDPVTPLPPPPAPRRCF
TCPQCRKSFPRRSFRPNLQLANMVQVIRQMHPTPGRGSRVTDQGICPKHQEALKLFCEVD
EEAICVVCRESRSHKQHSVVPLEEVVQEYKAKLQGHVEPLRKHLEAVQKMKAKEERRVTE
LKSQMKSELAAVASEFGRLTRFLAEEQAGLERRLREMHEAQLGRAGAAASRLAEQAAQLS
RLLAEAQERSQQGGLRLLQDIKETFNRCEEVQLQPPEVWSPDPCQPHSHDFLTDAIVRKM
SRMFCQAARVDLTLDPDTAHPALMLSPDRRGVRLAERRQEVADHPKRFGDASSSRHHHRR
RRLHLPQQPLLQREVWCVGTNGKRYQAQSSTEQTLLSPSEKPRRFGVYLDYEAGRLGFYN
AETLAHVHTFSAAFLGERVFPFFRVLSKGTRIKLCP
Download sequence
Identical sequences ENSGGOP00000020861 ENSGGOP00000020861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]