SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000021008 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000021008
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily PP2C-like 1.83e-56
Family PP2C-like 0.00000000288
Further Details:      
 
Domain Number 2 Region: 256-325
Classification Level Classification E-value
Superfamily Protein serine/threonine phosphatase 2C, C-terminal domain 5.1e-21
Family Protein serine/threonine phosphatase 2C, C-terminal domain 0.0000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000021008   Gene: ENSGGOG00000023836   Transcript: ENSGGOT00000034279
Sequence length 341
Comment pep:novel chromosome:gorGor3.1:8:15405795:15406867:-1 gene:ENSGGOG00000023836 transcript:ENSGGOT00000034279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRYELRSMQGWRIEMEDAHTAVIALPSGLERWSFFAVYNGHPGSQVAKYCCEHLLDHIAD
NQFTGSAGAPSLENVKNGIRTGFLEIDEHVSMSEKKHGADRSGSTDVSVLLSPQHNYFIN
YEDSRRLLCRNRKVHFFTNCQSARKRMNSHVKGSLAVSKALGDFDYKCIHGKGPTEQLVS
PEPEVHDTERSEEDDHFIILACDSIWDVMGNEELCGFVRSRLEVTDDPDKVCNEIVDTCL
HKGSQDNMCFPNAPKVSPEAAKKEAELGKYLECRVEEIIKKQGEGVPDLVHVVYTLANEN
IPRLPPGGELANKQNVIEAIYRRRNLYKNDDSDSTSTDAMC
Download sequence
Identical sequences ENSGGOP00000021008 ENSGGOP00000021008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]